- This document provides a set of instructions to annotate large sequence datasets with CATH functional family assignments.
- This document is currently considered 'beta' and is subject to change.
- All feedback / corrections / suggestions are welcome
- 12/07/2017 - First release
- 31/07/2017 - Update version of
cath-resolve-hits
- 06/02/2018 - Add tools to retrieve GO annotations
- 28/03/2019 - Bug fixes
- 17/12/2019 - Add fixed dbsize (-Z) to hmmsearch; --min-dc-hmm-coverage=80 to CRH
Clone a new project template from GitHub and move into the directory.
> git clone https://github.com/UCLOrengoGroup/cath-tools-genomescan.git myproject
> cd myproject/
> pwd
Note: this directory will be called ${PROJECTHOME}
for the rest of the tutorial.
Choose a genome and get all translated protein sequences in FASTA format.
The file ${PROJECTHOME}/data/test.fasta
containing two query sequences has been included in the template as an example.
> cd ${PROJECTHOME}
> cd data/
> cat test.fasta
>cath|4_1_0|2fupA
GXPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELPVLQQLLGAKQPLXQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIIRANQASTGSLLNILR
>cath|4_1_0|1cukA
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVARLVALGYKPQEASRMVSKIARPDASSETLIREALRAAL
Download and extract the recent HMMER3 software:
> cd ${PROJECTHOME}
> cd apps/
> wget http://eddylab.org/software/hmmer3/3.1b2/hmmer-3.1b2-linux-intel-x86_64.tar.gz
> tar zxf hmmer-3.1b2-linux-intel-x86_64.tar.gz
Create a link for convenience:
> cd ${PROJECTHOME}
> cd bin/
> ln -s ../apps/hmmer-3.1b2-linux-intel-x86_64/binaries hmmer3
Check to make sure the link and binaries work as expected:
> cd ${PROJECTHOME}
> ./bin/hmmer3/hmmscan -h
# hmmscan :: search sequence(s) against a profile database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Usage: hmmscan [-options] <hmmdb> <seqfile>
...
More information can be found on installing HMMER3 on the excellent HMMER documentation
Download the library of CATH FunFam (Functional Family) models and unzip.
We are using here the v4.2 CATH FunFam models. Check the most recent version here.
> cd ${PROJECTHOME}
> cd data/
> wget http://download.cathdb.info/cath/releases/all-releases/v4_2_0/sequence-data/funfam-hmm3-v4_2_0.lib.gz
> gunzip funfam-hmm3-v4_2_0.lib.gz
Use hmmpress
to index the HMM library:
> cd ${PROJECTHOME}
> cd data/
> ../bin/hmmer3/hmmpress funfam-hmm3-v4_2_0.lib
CATH FunFam assignments can now be generated by scanning the query sequences against the CATH FunFam model library. Only those which meet the FunFam inclusion threshold are reported.
> cd ${PROJECTHOME}
> ./apps/cath-genomescan.pl -i data/test.fasta -l data/funfam-hmm3-v4_2_0.lib -o results/
> cd ${PROJECTHOME}/results/
> ls
test.crh test.domtblout test.html
Three result files are generated in the results/
folder:
This is the main FunFam HMM scan result file generated using hmmsearch
. This file lists all FunFam matches (based on the E-value threshold used for scanning) for all sequences in the input fasta file.
The details of the hmmsearch results file format can be found here.
Note: The FunFam ID has the following pattern: 2.40.50.140/FF/58874 where the CATH superfamily ID of the FunFam match is 2.40.50.140 and the matched FunFam number within that superfamily is 58874. The four numbers in the superfamily ID (2.40.50.140) corresponds to each level in the CATH classification. For example, the 2 refers to the class to which the domain belongs (mainly beta), the 2.40 refers to the architecture (beta barrel), the 2.40.50 refers to the actual fold or topology the domain adopts (OB fold) and 2.40.50.140 is the homologous superfamily code.
This file is generated by cath-resolve-hits which collapses a list of domain matches to your query sequence(s) (test.domtbout
) down to the best, non-overlapping subset (i.e. domain architecture).
This FunFam scan result file displays the most confident non-overlapping domain matches across the query sequence(s) that matches a CATH FunFam along with the bit-scores and E-values of the matches. Each identified domain in a query sequence that matches a FunFam is represented by a different row. The matching region(s) for a domain can sometimes be discontinuous (in case of discontinuous domains), where more than one segment of the protein sequence forms the structural domain region.
An example is shown below:
> cd ${PROJECTHOME}/results/
> cat test.crh
#Generated by cath-resolve-hits, one of the cath-tools (https://github.com/UCLOrengoGroup/cath-tools)
#FIELDS query-id match-id score boundaries resolved cond-evalue indp-evalue
cath|4_1_0|1cukA 2.40.50.140/FF/58874 160.3 1-65 1-65 5.4e-52 1.1e-51
cath|4_1_0|1cukA 1.10.150.20/FF/4839 169.4 67-140 67-140 5.5e-55 1.1e-54
cath|4_1_0|1cukA 1.10.8.10/FF/15460 61.4 157-201 157-201 3.8e-21 7.5e-21
cath|4_1_0|2fupA 1.20.58.300/FF/1517 113 6-130 6-130 5.7e-37 1.1e-36
The two E-values in the .crh
file are:
-
conditional E-value: It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. (Refer to HMMER3 guide for more details).
-
independent E-value: the significance of the sequence in the whole database search, if this were the only domain we had identified. It’s exactly the same as the “best 1 domain” E-value in the sequence top hits list.
The indp-evalue (independent E-value) is most approriate for our purpose of getting the best-match FunFam for each domain-region. E-values < 0.001 are generally considered to be significant matches.
Point your web browser at this file to visualise the assigned domain architecture of your query sequence(s) using cath-resolve-hits as in test.crh
.
Look at the assigned domain architecture for the query sequence cath|4_1_0|1cukA
(figure above). There are three good domain matches (we generally consider E-values <0.001 as significant). So, it is likely, that your protein comprises three domains. The FunFams marked by blue box have a known structure.
There is only one good domain match that covers the entire length of the the query sequence cath|4_1_0|2fupA
(figure above). So, it is likely, that your protein comprises a single domain.
The FunFam alignments are available in STOCKHOLM format through a RESTful API that contains UniProt accessions of the FunFam member sequences along with their annotations such as Gene Ontology (GO) and Enzyme Commission Number (EC) annotations along with other meta-data.
The script ${PROJECTHOME}/apps/retrieve_FunFam_aln_GO_EC_anno_CATH-API.pl
uses the CATH API to fetch the FunFam alignment and returns GO terms of all characterised FunFam member sequences.
For retrieving alignments and GO annotation for a particular CATH FunFam:
cd ${PROJECTHOME}
./apps/retrieve_FunFam_aln_GO_EC_anno_CATH-API.pl 2.40.50.140/FF/58874 v4_2_0 ${PROJECTHOME}/results
The following result files will be available in the results/
folder:
> cd ${PROJECTHOME}/results/
> ls 2.40.50.140.FF.58874*
2.40.50.140.FF.58874.sto.aln 2.40.50.140.FF.58874.GO.anno 2.40.50.140.FF.58874.EC.anno
> cd ${PROJECTHOME}/results/`
> cat 2.40.50.140.FF.58874.sto.aln
# STOCKHOLM 1.0
#=GF ID 2.40.50.140/FF/58874
#=GF AC 2.40.50.140/FF/58874
#=GF DE Holliday junction DNA helicase RuvA
#=GF TP FunFam
#=GF DR CATH: v4.1
#=GF DR DOPS: 45.244
#=GS 1hjpA01/1-66 AC P0A809
#=GS 1hjpA01/1-66 OS Escherichia coli K-12
...
> cd ${PROJECTHOME}/results/
> head 2.40.50.140.FF.58874.GO.anno
FUNFAM_RELATIVE/DOMAIN_RANGE GO_ANNOTATIONS
1hjpA01/1-66 GO:0000725; GO:0003677; GO:0005524; GO:0005737; GO:0009378; GO:0009379; GO:0009432; GO:0032508; GO:0048476;
P66746/1-65 GO:0003677; GO:0005524; GO:0006281; GO:0006310; GO:0009378; GO:0009379; GO:0009432;
P0A809/1-65 GO:0000725; GO:0003677; GO:0005524; GO:0005737; GO:0009378; GO:0009379; GO:0009432; GO:0032508; GO:0048476;
Q83KR4/1-66 GO:0003677; GO:0005524; GO:0006281; GO:0006310; GO:0009378; GO:0009379; GO:0009432;
W1HVM5/1-66 GO:0003677; GO:0005524; GO:0006281; GO:0006310; GO:0009378; GO:0009432;
A0A0A2VCS0/983-1048 GO:0003677; GO:0004520; GO:0004812; GO:0005524; GO:0005737; GO:0006281; GO:0006310; GO:0006418; GO:0008828; GO:0009378; GO:0009379;
L7ACY6/1-63 GO:0005524; GO:0006281; GO:0006310; GO:0009378;
...
1c7yA01/1-66 3.6.4.12;
1cukA01/1-66 3.6.4.12;
1d8lA02/1-65 3.6.4.12;
1d8lB02/1-65 3.6.4.12;
1hjpA01/1-66 3.6.4.12;
P0A809/1-66 3.6.4.12;
P66746/1-66 3.6.4.12;
Q32HA0/1-66 3.6.4.12;
A6TB31/1-66 3.6.4.12;
Kindly note that the annotations in these alignments were retrieved from UniProt during the most recent database release.
Detailed CATH API documentation on accessing CATH FunFam data is available here:
https://github.com/sillitoe/cath-api-docs/blob/master/README.md#functional-families-funfams
Example usage in Perl and shell/cURL for accessing example CATH data via Restful API is shown below:
$ curl -w "\n" -s -X GET -H 'Accept: application/json' http://www.cathdb.info/version/v4_1_0/api/rest/superfamily/1.10.8.10/funfam/1302
#!/usr/bin/perl
use strict;
use warnings;
use LWP::UserAgent;
my $ua = LWP::UserAgent->new;
$ua->timeout(10);
$ua->default_header( 'Accept' => 'application/json' );
my $url = 'http://www.cathdb.info/version/v4_1_0/api/rest/superfamily/1.10.8.10/funfam/1302';
my $response = $ua->get( $url );
if ( $response->is_success ) {
print $response->decoded_content;
}
else {
die $response->status_line;
}